PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43937.1.p
Common NameBRADI_4g43937, LOC100821658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 335aa    MW: 36250 Da    PI: 6.8915
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43937.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.7e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Bradi4g43937.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding46.21.1e-1467112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++  E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Bradi4g43937.1.p  67 RGNFSSHEEAIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.785965IPR017930Myb domain
SuperFamilySSF466891.06E-2911108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001671.08E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2365117IPR009057Homeodomain-like
SMARTSM007172.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.53666116IPR017930Myb domain
PfamPF002491.5E-1267112IPR001005SANT/Myb domain
CDDcd001672.34E-969111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF SSHEEAIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKQQ  120
AMGAIFAPVP MPPTAPTFSS AAAQPEAAAY SGLLHHHQHD AIIGGASASF SSTVVDVKAA  180
AWRNDTSYRR RSPFAEATPC GGDSSSSAAS YASSMDNISR LLNGFMKSSP PPPAAAAHDV  240
KPAIIVEEVE DPFLSFDQHF SGATDLAFAG VPPPPLPALL TGGVHASYGE ETTRQQQQAP  300
LCSIEKWLLD EAVEQVADLM DDLSDGCCSL PLLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-26141164105C-Myb DNA-Binding Domain
1mse_C8e-26141164105C-Myb DNA-Binding Domain
1gv2_A9e-26141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3574781e-152AK357478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1054F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579000.10.0PREDICTED: transcription factor MYB30-like
TrEMBLI1IUV30.0I1IUV3_BRADI; Uncharacterized protein
STRINGBRADI4G43937.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-80myb domain protein 60